General Information

  • ID:  hor006503
  • Uniprot ID:  Q9W7F0
  • Protein name:  Somatostatin-27
  • Gene name:  sst1
  • Organism:  Protopterus annectens (African lungfish)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Protopterus (genus), Protopteridae (family), Lepidosirenoidei (suborder), Ceratodontiformes (order), Ceratodontae (superorder), Dipnomorpha (subclass), Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SANSSPLAARERKAGCKNFFWKTFTSC
  • Length:  27(89-115)
  • Propeptide:  MLSCRFQCALVLLSLAVVFSKVSAAPSDLRLRQLLQRSLAAAAGKQELTKYSLAELLSELAQSENDALDSSDLSRGADQDEVRLELDRSANSSPLAARERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRFQCALVLLSLAVVFSKVSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 177 seconds ( PubMed ID: 6127205 )

Structure

  • Disulfide bond:  16-27
  • Structure ID:  AF-Q9W7F0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006503_AF2.pdbhor006503_ESM.pdb

Physical Information

Mass: 347234 Formula: C132H203N39O38S2
Absent amino acids: DHIMQVY Common amino acids: AS
pI: 10.51 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -52.96 Boman Index: -5839
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 29.26
Instability Index: 4378.15 Extinction Coefficient cystines: 5625
Absorbance 280nm: 216.35

Literature

  • PubMed ID:  10398054##6127205
  • Title:  Molecular cloning of the cDNAs and distribution of the mRNAs encoding two somatostatin precursors in the African lungfish Protopterus annectens.